Catalytic Activity

Some articles on catalytic activity, catalytic, activity:

Proton Exchange Membrane Fuel Cell - Science - Catalyst Research - Increasing Catalytic Activity
... goal of catalyst design for PEM fuel cells is to increase the catalytic activity of platinum by a factor of four so that only one-fourth as much of the precious metal is necessary to achieve ... demonstrated additional ways to make further improvements to catalytic performance ... A second method of increasing the catalytic activity of platinum is to alloy it with other metals ...
Sphingomyelin Phosphodiesterase - Neutral Sphingomyelinase - Active Site
... and His-296 are known to be essential for activity ... The relative catalytic activities of SMase when metal ions are bound to the active site have been studied for divalent metal ions Co2+, Mn2+, Mg2+, Ca2+, and Sr2+ ... Of these five metal ions, Co2+, Mn2+, and Mg2+ bound to the active site result in high catalytic activity of SMase ...
Acetolactate Synthase - Catalytic Activity
... There are four specific residues that are responsible for catalytic activity in this enzyme ... Residues involved in catalytic activity are bolded ... Catalytic residues are bold TFISRFAPDQPRKGADILVEALERQGVETVFAYPGGASMEIHQALTRSSSIRNVLPRHEQGGVFAAEGYARSSGKPGICIATSGPGATNLVSGLADALLD ...
PTPRT - Tyrosine Phosphatase Activity
... The first catalytic domain of Type R2B RPTPs is considered the active phosphatase domain, whereas the second phosphatase domain is thought to be inactive ... however, result in a reduction of phosphatase activity of PTPrho ... domain in colorectal cancer cells also reduces PTPrho catalytic activity, again demonstrating that the second phosphatase domain of PTPrho does regulate ...
Ammonium Metavanadate - Metallurgy
... has been mixed with basic copper carbonate to make a new compound with better catalytic activity than the two separate compounds ... In the study by Shaheen and Maksod, catalytic activity of different molar ratios of ammonium metavanadate in comparison with the two original compounds was examined at different ... Catalytic activity was measured “using hydrogen peroxide decomposition at 30, 40, and 50°C” for pure and mixed compounds ...

Famous quotes containing the word activity:

    You must learn to be still in the midst of activity and to be vibrantly alive in repose.
    Indira Gandhi (1917–1984)